PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast04G123400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 352aa    MW: 39815.4 Da    PI: 6.6765
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast04G123400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.77.7e-5671361129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvka.eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPtdeelv++yL+kkv++kk++l +vik+vd+yk+ePwdL+ k k+   e+++wyfFs++dkky+tg+r+nrat +g+Wkatg+
  Brast04G123400.1.p   7 VPPGFRFHPTDEELVDYYLRKKVASKKIDL-DVIKDVDLYKIEPWDLQdKcKIGMeEQSDWYFFSHKDKKYPTGTRTNRATGAGFWKATGR 96 
                         69****************************.9***************9434444324559******************************* PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         dk++++ ++ lvg++ktLvfykgrap+g+k+dW+mheyrle
  Brast04G123400.1.p  97 DKPIYT-NNCLVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                         ******.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-625156IPR003441NAC domain
PROSITE profilePS5100560.0897156IPR003441NAC domain
PfamPF023651.8E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MDTFSHVPPG FRFHPTDEEL VDYYLRKKVA SKKIDLDVIK DVDLYKIEPW DLQDKCKIGM  60
EEQSDWYFFS HKDKKYPTGT RTNRATGAGF WKATGRDKPI YTNNCLVGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETNEN GATPEEGWVV CRVFKKRVAT VRRMADSSPC WFDDHGSGAF  180
MPDLDSPRQL GYHHQNVAAY HSQQQQQLYH CKPELEYHHL LPQEAFLQQL PHLESPKPQA  240
YIGQGSSNIL STTGNLLAHD GGASRPSVQQ PPMDQSLYMA AAGDTSATDW RLLDKFVASQ  300
LFSHGDTNPK DPSYSGETEQ LFQAENKHEE ALDYASTSAG GSGGGESRLW K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-52715717166NAC domain-containing protein 19
4dul_A2e-52715717166NAC domain-containing protein 19
1ut7_B2e-52715717166NO APICAL MERISTEM PROTEIN
1ut7_A2e-52715717166NO APICAL MERISTEM PROTEIN
1ut4_B2e-52715717166NO APICAL MERISTEM PROTEIN
1ut4_A2e-52715717166NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6934240.0JQ693424.1 Brachypodium distachyon SWN3 (SWN3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266811.10.0uncharacterized protein LOC100832773
RefseqXP_010233638.10.0PREDICTED: uncharacterized protein LOC100832773 isoform X1
SwissprotQ9FWX21e-121NAC7_ARATH; NAC domain-containing protein 7
TrEMBLI1IC130.0I1IC13_BRADI; SWN3
STRINGBRADI3G50067.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23703892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-100NAC 007